PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01801.1.g00110.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 242aa    MW: 26914 Da    PI: 4.8543
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01801.1.g00110.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-193185256
                                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                    r++ +f++eq++ Le++F+ + ++ ++++ +LA++lgL+ rqV +WFqN+Ra++k
  Zpz_sc01801.1.g00110.1.sm.mkhc 31 RNKKRFSEEQIKSLESMFATQTKLEQRQKLQLARELGLQPRQVAIWFQNKRARWK 85
                                    67789*************************************************9 PP

2HD-ZIP_I/II118.24.5e-3832123293
                     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerL 80 
                                     +k+r+s+eq+k+LE++F +++kLe+++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+aL++ ydal  + e+L
  Zpz_sc01801.1.g00110.1.sm.mkhc  32 NKKRFSEEQIKSLESMFATQTKLEQRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYDALLCSYESL 110
                                     79***************************************************************************** PP

                     HD-ZIP_I/II  81 ekeveeLreelke 93 
                                     +ke+++L ++l++
  Zpz_sc01801.1.g00110.1.sm.mkhc 111 KKEKHALLKQLEK 123
                                     ********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-191688IPR009057Homeodomain-like
SuperFamilySSF466899.61E-192589IPR009057Homeodomain-like
PROSITE profilePS5007117.672787IPR001356Homeobox domain
SMARTSM003899.3E-163091IPR001356Homeobox domain
PfamPF000461.1E-163185IPR001356Homeobox domain
CDDcd000868.89E-173188No hitNo description
PRINTSPR000317.9E-65867IPR000047Helix-turn-helix motif
PROSITE patternPS0002706285IPR017970Homeobox, conserved site
PRINTSPR000317.9E-66783IPR000047Helix-turn-helix motif
PfamPF021836.5E-1387129IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEGDEDVPEW MMDAGGASGG KRKGGGGAVD RNKKRFSEEQ IKSLESMFAT QTKLEQRQKL  60
QLARELGLQP RQVAIWFQNK RARWKSKQLE REYSALRDDY DALLCSYESL KKEKHALLKQ  120
LEKLAEMLQE PGPKYGSNAV DALTGDDDSL KVVTGMKEEF SDVRPAAPYS SVEEAGGAGK  180
FTPFADDAAG NLFRPPPQPP AGFTASGPLE HQPFQFQSSF WPSSAEQTCG SSQWWELESL  240
SE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11826GGKRKGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001183573.11e-113putative homeobox DNA-binding and leucine zipper domain family protein
SwissprotQ651Z56e-87HOX6_ORYSJ; Homeobox-leucine zipper protein HOX6
SwissprotQ9XH356e-87HOX6_ORYSI; Homeobox-leucine zipper protein HOX6
TrEMBLA0A0A9CR231e-122A0A0A9CR23_ARUDO; Uncharacterized protein
STRINGGRMZM2G041462_P011e-112(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78733448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.12e-42homeobox 7